DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:269 Identity:118/269 - (43%)
Similarity:166/269 - (61%) Gaps:21/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVVFLGLTLVAAGSAKKDSE--------DPDHIITNGSPAYEGQAPYVVGMAF-GQSNIWCS 56
            |||. |||.|.:.||.:....::        |....||||.|||||:.||:||:.| |..|.||.
  Fly     1 MKLF-VFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCG 64

  Fly    57 GTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSE------YVTGNQH--LALVRV 113
            |:|||:||:||:|.|..|:|||||.:||:..:|.|:|..||:.:      |.:||.|  ::|:|.
  Fly    65 GSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRT 129

  Fly   114 PRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYG 178
            |.|.|.:.||:|.|||..:|.|.|..|||...|||.|...:.|.|.||.||:||:|.::|...: 
  Fly   130 PHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTW- 193

  Fly   179 STTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARITSALDW 243
              ::.|.::|..|..|:|||.||:|.||:|...:.:||:::|.::.||..|.||.|:|:|..|||
  Fly   194 --SLHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDW 256

  Fly   244 IHQRTGIAY 252
            |...|||:|
  Fly   257 IRDNTGISY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 104/225 (46%)
Tryp_SPc 29..244 CDD:214473 102/223 (46%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 104/226 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470801
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.