DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG11843

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:256 Identity:59/256 - (23%)
Similarity:98/256 - (38%) Gaps:52/256 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IITNGSPAYEGQAPYVVGMA-----FGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRL 87
            :|..|.||...:.|::..:.     ..:::.:|.|.:|.:.::||:|.||....|..   ...||
  Fly    67 LIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEV---NVVRL 128

  Fly    88 SQAQF---TVTVGTSEYVTGN-------------QHLALVRVPR-VGFSNRVNRVALPSLRNRSQ 135
            .:..|   .......:|:...             ..:.||::.. |.|....:...||....||.
  Fly   129 GELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSS 193

  Fly   136 RYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQI------------LC 188
              :::.|  .|||.|..:...:..|..|.||...|..|     ...::.|:            ||
  Fly   194 --DSFIA--VGWGSTGLALKPSAQLLKVKLQRYGNWVC-----KKLLTRQVEEFPRGFDGNNQLC 249

  Fly   189 TRTPSGRSTCFGDAGSPLITKQDS-----TVVGISAFVASNGCTLGLPAGFARITSALDWI 244
            ..:...:.||.||:|.||:.....     .||||::...|.| :.|:|..:.|:...|.||
  Fly   250 VGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCG-SPGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 59/255 (23%)
Tryp_SPc 29..244 CDD:214473 57/253 (23%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 59/255 (23%)
Tryp_SPc 68..309 CDD:214473 57/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.