DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG4815

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:207 Identity:50/207 - (24%)
Similarity:81/207 - (39%) Gaps:51/207 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYVT--GN--QHL 108
            |....:.||.|::....|||:|.|.            ..|::::|.|..|.|...|  ||  ...
  Fly    54 FNGRKLVCSATLLTPRHILTAAHCF------------ENLNRSKFHVIGGKSAEFTWHGNNFNKN 106

  Fly   109 ALVRV---PRVGFSNRVNRVALPS----LRNRSQRYENWWANVC-------------GWGVTTFS 153
            .|:||   |:......:..||:..    ||::...|    |.:|             |||   |.
  Fly   107 KLIRVQIHPKYAKMKFIADVAVAKTKYPLRSKYIGY----AQLCRSVLHPRDKLIAAGWG---FE 164

  Fly   154 NGLTD-----ALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDST 213
            .|:.|     ..:.:.:.|:|..:|.... ...:...|:|....:.::.||||:|.||:..:.  
  Fly   165 GGVWDESRKKTFRSMKVGIVSKRDCEKQL-DRKMPPNIICAGAYNNKTLCFGDSGGPLLLGRQ-- 226

  Fly   214 VVGISAFVASNG 225
            |.||:.:....|
  Fly   227 VCGINTWTFKCG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 50/207 (24%)
Tryp_SPc 29..244 CDD:214473 50/207 (24%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 50/207 (24%)
Trypsin 49..256 CDD:278516 50/207 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.