DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and SPE

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:242 Identity:54/242 - (22%)
Similarity:95/242 - (39%) Gaps:59/242 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CSGTIIGDTWILTSAQCLTG----SSGVTIYFGATRLSQAQFTVTVGTSEYVTGNQ--------- 106
            |.|.::...::||:..||..    .||..::  :.||.:.........:..:.|.:         
  Fly   166 CGGALLNSRYVLTAGHCLASRELDKSGAVLH--SVRLGEWDTRTDPDCTTQMNGQRICAPKHIDI 228

  Fly   107 --------------------HLALVRVPR-VGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVT 150
                                .:||||:.| |.:::.|..:.||:.......:.::..:|.||   
  Fly   229 EVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGW--- 290

  Fly   151 TFSNGLTDALQ--CVDLQIMSN----NECIAFYGSTTV--SDQILCTRTPSGRSTCFGDAGSPLI 207
                |||:.:|  .:.|:|..|    ..|...|.|..|  .|..:|.....|..||.||:|.||:
  Fly   291 ----GLTENMQPSAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLM 351

  Fly   208 T------KQDSTVVGISAFVASNGCTL-GLPAGFARITSALDWIHQR 247
            .      :....:.|:::: .:..|.| |.|..:.|..:.:|||.|:
  Fly   352 VPISTGGRDVFYIAGVTSY-GTKPCGLKGWPGVYTRTGAFIDWIKQK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 53/239 (22%)
Tryp_SPc 29..244 CDD:214473 51/237 (22%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 53/240 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.