DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG16710

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:275 Identity:62/275 - (22%)
Similarity:107/275 - (38%) Gaps:69/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDHIITNGSPAYEGQAPY--VVGMAFGQSNIW-------CSGTIIGDTWILTSAQCL--TGSSGV 78
            |.:.|..|......:.|:  ::..|....::|       |:|::|.:.::||:|.||  ||....
  Fly   102 PAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLR 166

  Fly    79 TIYFGATRLSQAQFTVTVGTSEYVTGNQH-----------LALVRVPRVGFSNR-VNRVALPSLR 131
            .:..|...:......||     ::.|.:|           |::.....:.|..| .|.:||..|:
  Fly   167 RVRLGEHNILSNPDCVT-----HINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIALLRLK 226

  Fly   132 ---------------------NRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSN----N 171
                                 |.|  :.|....:.|||: :...|.::.|    ||...|    :
  Fly   227 FPVRYTAQIKPICVQLDYIFSNPS--FSNHKLQIAGWGL-SHKQGYSNVL----LQAYVNGRNAD 284

  Fly   172 ECIAFYGSTTVSDQI-LCTRTPSGRSTCFGDAGSPLIT---KQDSTVV---GISAFVASNGCTLG 229
            ||.....|..:..:. :|.....|..||.||:|.||:.   :.|...|   ||:::..|. |..|
  Fly   285 ECSLSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQ-CGYG 348

  Fly   230 LPAGFARITSALDWI 244
             ||.:.:.:..::||
  Fly   349 -PAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 61/271 (23%)
Tryp_SPc 29..244 CDD:214473 59/269 (22%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 59/270 (22%)
Tryp_SPc 106..362 CDD:238113 59/269 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.