DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG5255

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:286 Identity:70/286 - (24%)
Similarity:106/286 - (37%) Gaps:67/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVVFLGLTLVAAGSAKKDSEDPDHI---ITNGSPAYEGQAPYVVGM-AFGQSNIWCSGTIIGDT 63
            :|::.|.|.|..:.:|.:....|.:.   |..|..|..|.|||.:.: ..|.....|.|.||.:.
  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDER 65

  Fly    64 WILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSE-YVTGNQHLALVRVPRVGFSNRV----- 122
            ||:|:|.|..|.....            |.|..||.: :..|:::....|:  |..||..     
  Fly    66 WIITAAHCTRGRQATA------------FRVLTGTQDLHQNGSKYYYPDRI--VEHSNYAPRKYR 116

  Fly   123 NRVALPSLRNRSQRYENWWANV---------------CGWGVTTFSNGLTDALQCVDLQIMSNNE 172
            |.:||..| |.|..::|....|               .|||..:....:...||.:::..:...:
  Fly   117 NDIALLHL-NESIVFDNATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQ 180

  Fly   173 CIAFY-GSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNG----------- 225
            |.|.: .||.|....:||....||..|.||:|.||:               .||           
  Fly   181 CRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV---------------HNGKLVALVNWGLP 230

  Fly   226 CTLGLPAGFARITSALDWIHQRTGIA 251
            |..|.|...|.|:...|:|.....::
  Fly   231 CAKGYPDAHASISYYHDFIRTHLSLS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 64/250 (26%)
Tryp_SPc 29..244 CDD:214473 63/248 (25%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 63/249 (25%)
Tryp_SPc 30..252 CDD:238113 64/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436839
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.