DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG5246

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:289 Identity:68/289 - (23%)
Similarity:116/289 - (40%) Gaps:69/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVVFLGLTLVAAGSAKK-------------DSEDPDHIITNGSPAYEGQAPYVVGM--AFGQ 50
            ||.||:...|.:::..|||.             ....|:..:..|..:..|.|||.|.:  .||:
  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGE 65

  Fly    51 SNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEY--------VTGNQ- 106
            .  .|.|:||...||||:|.|:..    .|.:         ..:..||.:|        |.|:: 
  Fly    66 H--VCGGSIIAPQWILTAAHCMEW----PIQY---------LKIVTGTVDYTRPGAEYLVDGSKI 115

  Fly   107 -----------HLALVRVPR-VGFSNRVNRV------ALPSLRNRSQRYENWWANVCGWGVTTFS 153
                       .:||:...: :.:.:....:      :||.:.::        ..:.|||.|...
  Fly   116 HCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDK--------LTLTGWGSTKTW 172

  Fly   154 NGLTDALQCVDLQIMSNNECIA-FYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGI 217
            ...:..||.:||..:.::.|.: ...:..:|:..:||.|..|..:|.||:|.||: ..:.|:||:
  Fly   173 GRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLV-DANQTLVGV 236

  Fly   218 SAFVASNGCTLGLPAGFARITSALDWIHQ 246
            ..:  ...|.:|.|..|..:....|||.|
  Fly   237 VNW--GEACAIGYPDVFGSVAYYHDWIEQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 58/246 (24%)
Tryp_SPc 29..244 CDD:214473 56/244 (23%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 56/245 (23%)
Tryp_SPc 42..263 CDD:238113 58/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436838
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.