DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG4053

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:273 Identity:71/273 - (26%)
Similarity:111/273 - (40%) Gaps:58/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVFLGLTL-VAAGSAKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQSNIW----CSGTIIGDTW 64
            ::.||.:: |..|....:.:..|:.|..|..|.:|.|||.|.:    ..||    |||.|:.:.|
  Fly    10 LLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSI----QTIWKTHICSGVILNEQW 70

  Fly    65 ILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSE----------------------YVTGNQH 107
            |||:..|            |...|.....:.|||::                      ||..|. 
  Fly    71 ILTAGHC------------ALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYVYNND- 122

  Fly   108 LALVRV-PRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNN 171
            :||:.| ..:.|::|...|.|    :|.|........:.|||....|......||.::|.|:::.
  Fly   123 IALIHVNESIIFNDRTQIVEL----SREQPPAGSTVTLTGWGAPESSYPTVQYLQTLNLTIIAHE 183

  Fly   172 ECIA---FYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAG 233
            ||..   |:....:..  :||.|..|...|.||:|.||:  .:..:||:..:  ...|.:|:|..
  Fly   184 ECRERWDFHDGIDIGH--ICTFTREGEGACSGDSGGPLM--WEGKLVGLVNW--GRACGVGMPDM 242

  Fly   234 FARITSALDWIHQ 246
            :|......|||.:
  Fly   243 YANTVYYQDWIRR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 66/246 (27%)
Tryp_SPc 29..244 CDD:214473 64/244 (26%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 64/245 (26%)
Tryp_SPc 35..256 CDD:238113 66/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.