DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG17475

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:297 Identity:72/297 - (24%)
Similarity:110/297 - (37%) Gaps:89/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVVFLGLTL---VAAGSAKKDSEDP------------DHIITNGSPAYEGQAPYVVGMAFGQ 50
            :::||:.|..|.   ::|....:.|||.            .:.:.||.....|:|.|.:.:....
  Fly     7 VQILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMY 71

  Fly    51 SNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYVTGN------QH-- 107
            ....|.|.||.:..:||:|.|:.|       :..|.|     .|..||.||...:      :|  
  Fly    72 GGHICGGCIIDERHVLTAAHCVYG-------YNPTYL-----RVITGTVEYEKPDAVYFVEEHWI 124

  Fly   108 ------------LALVRV-PRVGFSNRVNRVALPS--LRNRSQRYENWWANVCGWGVTTFSNGLT 157
                        :||:|: ..:.|:.......||:  :.|.:|..      :.|||.|.......
  Fly   125 HCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLL------LTGWGSTELWGDTP 183

  Fly   158 DALQCVDL---------QIM----SNNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITK 209
            |.||...|         :||    ||..|            .:||.|..|:..|.||:|.||   
  Fly   184 DILQKAYLTHVVYSTCQEIMNNDPSNGPC------------HICTLTTGGQGACHGDSGGPL--- 233

  Fly   210 QDSTVVGISAFVASNG--CTLGLPAGFARITSALDWI 244
               |..|:...:.:.|  |.||:|...|.:...|:||
  Fly   234 ---THNGVLYGLVNWGYPCALGVPDSHANVYYYLEWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 64/254 (25%)
Tryp_SPc 29..244 CDD:214473 62/252 (25%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 62/253 (25%)
Tryp_SPc 50..269 CDD:238113 64/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.