DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG31265

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:243 Identity:60/243 - (24%)
Similarity:98/243 - (40%) Gaps:46/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGM--AFGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQ 91
            |..|..|..|.|||.|.:  ..|..|  |.|.|:.:.||:|:..|:            .....|.
  Fly    37 IKGGEEAEIGFAPYQVSLQPIVGSHN--CGGAILNENWIITAGHCV------------ENFIPAL 87

  Fly    92 FTVTVGTSE-------YVTGNQH-------------LALVRV-PRVGFSNRVNRVALPSLRNRSQ 135
            ..|..||::       |.|...|             :|||:: ..:.|:.....:|||:  ...|
  Fly    88 VNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPT--RPVQ 150

  Fly   136 RYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECI-AFYGSTTVSDQILCTRTPSGRSTCF 199
            ..|.  ..:.|||.........:.|..:.:.::..:||. .|..::::....:||.:..|...|.
  Fly   151 LGEE--IVLTGWGSDVAYGSSMEDLHKLTVGLVPLDECYETFNRTSSMGVGHICTFSREGEGACH 213

  Fly   200 GDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARITSALDWIHQR 247
            ||:|.||::  :..:||:..:  ...|.:|||...|.:...||||..:
  Fly   214 GDSGGPLVS--NGQLVGVVNW--GRPCGVGLPDVQANVYYYLDWIRSK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 60/240 (25%)
Tryp_SPc 29..244 CDD:214473 58/238 (24%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 58/238 (24%)
Tryp_SPc 39..257 CDD:238113 59/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.