DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and modSP

DIOPT Version :10

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:218 Identity:44/218 - (20%)
Similarity:68/218 - (31%) Gaps:65/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PYVVGMAFGQSNIW---------CSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTV 96
            |:.||:     .:|         |.|:::....::|:|.|        :|...|||..:..|..|
  Fly   381 PWHVGL-----YVWHNEKDYHFQCGGSLLTPDLVITAAHC--------VYDEGTRLPYSYDTFRV 432

  Fly    97 GTSEYV---------------------------TGN--QHLALVRVPRVGFSNRVNR---VALPS 129
            ..:::.                           |.|  |.|||:.:......:.|.|   |...|
  Fly   433 IAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFAS 497

  Fly   130 LRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSG 194
            ...:....::......||.:..     ...||.|.....||:.|..  ....:.....|..|...
  Fly   498 FAEKESVTDDVQGKFAGWNIEN-----KHELQFVPAVSKSNSVCRR--NLRDIQADKFCIFTQGK 555

  Fly   195 RSTCFGDAG----SPLITKQDST 213
            ...|.||:|    |.|.|...||
  Fly   556 SLACQGDSGGGFTSELPTNAFST 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..244 CDD:214473 44/218 (20%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Tryp_SPc 371..616 CDD:214473 44/218 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.