DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG3505

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:238 Identity:53/238 - (22%)
Similarity:89/238 - (37%) Gaps:66/238 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQ--------AQFTVTVGTSEYVTGNQHLALV 111
            |.|.:|.|.::||:|.|:..::...:...|.||.:        .|:......::.....|.:|:.
  Fly   137 CGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIE 201

  Fly   112 RVPRVGFSNRVNR-----------------------VALPSLRNRSQRYENWWANVCGWGVTTFS 153
            .:......||.:|                       :.||:.:.|:...|:....|.||..::  
  Fly   202 ELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGWQASS-- 264

  Fly   154 NGLTDALQCVDLQIMSNNECIAFYGSTTVSDQI--LCTRTPSGRSTCFGDAGSPL-ITKQDSTVV 215
               :..::...:.|.|..||...|.|..:..|.  ||..|.|  ..|:|:||.|| :.|.|..::
  Fly   265 ---SQRMRKGYVTISSIEECQRKYASQQLRIQASKLCGLTNS--QECYGNAGGPLMLFKNDGYLL 324

  Fly   216 GISAFVASNGCTLGL-------------PAGFARITSALDWIH 245
            |            ||             |..:.|:.|.:||||
  Fly   325 G------------GLVSFGPVPCPNPDWPDVYTRVASYIDWIH 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 53/238 (22%)
Tryp_SPc 29..244 CDD:214473 50/235 (21%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 53/238 (22%)
Tryp_SPc 111..354 CDD:214473 50/235 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.