DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG9649

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:265 Identity:61/265 - (23%)
Similarity:98/265 - (36%) Gaps:72/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYV------VGMAFGQSNIWCSGTIIGDTWILTSAQC-------LTG------ 74
            |.||.....||.|::      ||..:   |..|.||:|....::::|.|       |.|      
  Fly   257 IHNGIEVERGQLPWMAALFEHVGRDY---NFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVS 318

  Fly    75 ---------SSGVTIYFGATR-LSQAQFTVTVGTSEYVTGNQHLALVRVPRVGFSNRV------- 122
                     |||.|:  |..| |...|:...|.|      :..|||:::     ||.|       
  Fly   319 LGRNSLDLFSSGATL--GVARLLIHEQYNPNVYT------DADLALLQL-----SNHVDIGDYIK 370

  Fly   123 -----NRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNEC---IAFYGS 179
                 |...|..|.:..:.|      |.|||.....|..|...:..|..|::..||   ::...:
  Fly   371 PICLWNENFLLELPSGHKSY------VAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENA 429

  Fly   180 TTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVA-----SNGCTLGLPAGFARITS 239
            ..::...:|.........|.||:|..|:. |:..:..:...|:     :|.|.|.||..:..:..
  Fly   430 KFITSHTICASNAQASGPCSGDSGGGLML-QEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAK 493

  Fly   240 ALDWI 244
            .::|:
  Fly   494 HIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 61/265 (23%)
Tryp_SPc 29..244 CDD:214473 60/263 (23%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 60/263 (23%)
Tryp_SPc 259..497 CDD:214473 59/260 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471101
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.