DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG8870

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:271 Identity:51/271 - (18%)
Similarity:96/271 - (35%) Gaps:68/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TNGSPAYEGQAPYVVGMAFGQSNIW-------CSGTIIGDTWILTSAQCL--------------- 72
            |.|......:.|::..:.:|..|..       |.|::|.:.::||:|.|:               
  Fly    85 TKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVR 149

  Fly    73 TGSSGVT------IYFGATRLSQAQFTVTVGTSEYVTGNQ---------HLALVRVP-RVGFSNR 121
            .|....:      |..|  |...|...:.:...:.:|..|         .:||||:. .|.::..
  Fly   150 LGEHNTSTNPDRAIVNG--RRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRA 212

  Fly   122 VNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSN--------NECIAFYG 178
            :..:.||..:..:.....:.|:  ||         .|..|.:..:::..        :.|.:.|.
  Fly   213 IQPICLPRAQKLAAHKRKFQAS--GW---------PDMGQGIASEVLLRSFIAERHPDVCKSNYD 266

  Fly   179 STTVSDQILCTRTPSGRSTCFGDAGSPLITK--QDSTVVGISAFVASNG---CTLGL--PAGFAR 236
            ....|.  :|.....|..|..||:|.||:..  :....:..:|.:.|.|   |.|..  ||.:.:
  Fly   267 FNLGSQ--ICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTK 329

  Fly   237 ITSALDWIHQR 247
            .:...:||..:
  Fly   330 TSYFFEWIKSK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 51/268 (19%)
Tryp_SPc 29..244 CDD:214473 49/266 (18%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 49/261 (19%)
Tryp_SPc 93..337 CDD:214473 47/258 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.