DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG13318

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:262 Identity:65/262 - (24%)
Similarity:104/262 - (39%) Gaps:71/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TNGSPAYEGQAPYVVGMAFG----QSNIWCSGTI-IGDTWILTSAQCLTGSSGVTIYFGATRLSQ 89
            |..:|   |||      :||    |:.:..:..: :|...::|:...||.:..|      ..|..
  Fly   162 TTAAP---GQA------SFGAYPWQAALLTTADVYLGGGALITAQHVLTAAHKV------YNLGL 211

  Fly    90 AQFTVTVG------TSE-------YVTG------------NQHLALVRVPR-VGFSNR--VNRVA 126
            ..|.|.:|      |||       |::.            ...:|::::.. |..:::  |..|.
  Fly   212 TYFKVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVC 276

  Fly   127 LPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQC----VDLQIMSNNECIAFYGSTTVSD--- 184
            ||:.....||   .|  |.|||...|  |.|.|.|.    ||:.::.|..|.|...:|.:..   
  Fly   277 LPTTSFVGQR---CW--VAGWGKNDF--GATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFV 334

  Fly   185 ----QILCTRTPSGRSTCFGDAGSPLITKQDST--VVGISAFVASNGCT-LGLPAGFARITSALD 242
                ..:|....:|:..|.||.||||:...:..  |||:.|:  ..||. .|:|..:..:.:.|.
  Fly   335 LSPTSFICAGGEAGKDACTGDGGSPLVCTSNGVWYVVGLVAW--GIGCAQAGVPGVYVNVGTYLP 397

  Fly   243 WI 244
            ||
  Fly   398 WI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 65/262 (25%)
Tryp_SPc 29..244 CDD:214473 63/260 (24%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 61/252 (24%)
Tryp_SPc 169..399 CDD:214473 59/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.