DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG18223

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:302 Identity:76/302 - (25%)
Similarity:118/302 - (39%) Gaps:95/302 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVVFLGLTLVAAGSAKKDSEDP--DHIITN-----GSPAYEGQ-----APYVVGM-------AF 48
            ||.:.|.|.::.||       ||  .|.:..     .||.::.:     |.|||.:       .|
  Fly    16 LLFLLLLLPILDAG-------DPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLF 73

  Fly    49 GQSNIWCSGTIIGDTWILTSAQC------LTGSSGVTIYFGAT--RLSQA--------------- 90
            | .|.:|.|.||..|:|||||.|      :...|.|.:....|  ||...               
  Fly    74 G-DNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVP 137

  Fly    91 -QFTVTVGTSEYVTGNQHLALVRV--------PRVGFSNRVNRVALPSLRNRSQRYENWWANVCG 146
             :|||      :.|.|  :||:.:        |.||..|.......|.|        |:  .|.|
  Fly   138 DKFTV------FNTNN--IALMMLAKKLPLDNPLVGVINLPTADPEPGL--------NY--TVLG 184

  Fly   147 WGVTTFSNG-LTDALQCVDLQIMSNNEC---IAFYGSTTVSDQILCT---RTPSGRSTCFGDAGS 204
            || ..|..| |...:..:|::::..:.|   :..:     .::::|.   ......:.|.||.||
  Fly   185 WG-RIFKGGPLASDILHIDVELLPRDICEKKVHIF-----KEEMMCAGNLNNTMDENPCAGDTGS 243

  Fly   205 PLITKQDSTVVGISAFVASNGC-TLGLPAGFARITSALDWIH 245
            |||..:  ||.|:.::..  || :..||:.:..:...:|||:
  Fly   244 PLIFNE--TVFGVVSYRV--GCGSKTLPSIYTNVYMHMDWIN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 67/274 (24%)
Tryp_SPc 29..244 CDD:214473 65/271 (24%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 64/251 (25%)
Tryp_SPc 60..280 CDD:214473 62/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.