DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Jon74E

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:241 Identity:71/241 - (29%)
Similarity:118/241 - (48%) Gaps:19/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAFGQSN---IWCSGTIIGDTWILTSAQCLTGSSGVTIYFGAT-RLSQ 89
            |..|..|...|.||.||::..:.|   .||..::|.|.::||:|.|:..:..:|.|.|.. ||:.
  Fly    32 IAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAP 96

  Fly    90 AQFTVTVGTSEYV-------TGNQHLALVRVPRVG-FSNRVNRVALPSLRNRSQRYENWWANVCG 146
            .|...:.....::       :....:||||:|... ..:.:..:.||.|.:....|:...|...|
  Fly    97 RQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASG 161

  Fly   147 WG-VTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLI--- 207
            || :...|..::|.|:.|...:.||.:|  .|....:....:|..|..|:|||.||:|.||:   
  Fly   162 WGRMNDESTAISDNLRYVYRFVESNEDC--EYSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSD 224

  Fly   208 -TKQDSTVVGISAFVASNGCTLGLPAGFARITSALDWIHQRTGIAY 252
             .:....::|::::...:|||.|.|:.|.|||:.||||.:.:|:.|
  Fly   225 PVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGVHY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 69/233 (30%)
Tryp_SPc 29..244 CDD:214473 67/231 (29%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 67/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.