DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG33460

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:179 Identity:36/179 - (20%)
Similarity:62/179 - (34%) Gaps:62/179 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYVTGNQHLA----LVR 112
            :|:|:||:|.|.:|||:|.|:..:        |.::...:|    |.........||.    :.|
  Fly    54 SIFCAGTLITDVFILTAASCIRPN--------AVKVRLGEF----GRYPNELPEDHLVHYFLMYR 106

  Fly   113 VPRVGFSNR--VNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIA 175
            :    |:|.  .|.:.|..|..|.|                    :||.:..|.:.:...|:.::
  Fly   107 L----FNNESLANNIGLLKLTKRVQ--------------------ITDYIMPVCIVLNPQNQQLS 147

  Fly   176 ---FYGSTTVSDQ-----------------ILCTRTPSGRSTCFGDAGS 204
               |.|:..:.|.                 .:||........|.|..|:
  Fly   148 TMRFIGNAWMEDSNVSLTKELRPIVIQSKPKMCTNLDLYTQFCAGHQGN 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 36/179 (20%)
Tryp_SPc 29..244 CDD:214473 36/179 (20%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 36/179 (20%)
Tryp_SPc 44..249 CDD:214473 36/179 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436103
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.