DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and sphinx2

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:260 Identity:72/260 - (27%)
Similarity:127/260 - (48%) Gaps:15/260 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVVFLGLTLVAAGSAKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQSNI----WCSGTIIG 61
            |||:|..|.|:|..: ..:|:...|.  ||.|..|......|:||:.:.:|.:    :.:||||.
  Fly     1 MKLVVALLVLSLTFS-VCEKNKLSPR--ITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIIS 62

  Fly    62 DTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEY---VTGNQHLALVRVPRVGFSNRVN 123
            :.||||..:.|. ...:..:||:.|.......:.:....:   ....:.:|||:.|...|..|::
  Fly    63 NQWILTVKEVLI-FKYIEAHFGSKRAFWGYDILRIYRENFYFHYDKTRIIALVKCPYQKFDRRMS 126

  Fly   124 RVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILC 188
            ||.:|:...|.:||......|||||.......|...::||::::|:|.||..::  |.:....:|
  Fly   127 RVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTWMRCVEVEVMNNTECAKYH--TPLKWYEMC 189

  Fly   189 TRTPSGRSTCFGDAGSPLITK-QDSTVVGISAFVASNGCTLGLPAGFARITSALDWIHQRTGIAY 252
            |.....:..|.||.|..::|. .:.|.:||...:.:| |::|.|:...|::..:.||...:|:.:
  Fly   190 TSGEGFKGVCEGDMGGAVVTMGPNPTFIGIIWLMPTN-CSIGYPSVHIRVSDHIKWIKHVSGVGF 253

  Fly   253  252
              Fly   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 62/224 (28%)
Tryp_SPc 29..244 CDD:214473 60/222 (27%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 60/225 (27%)
Tryp_SPc 26..248 CDD:304450 62/225 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470985
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.