DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:274 Identity:105/274 - (38%)
Similarity:150/274 - (54%) Gaps:27/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVVFLGLTLVAAGSAKKDSE------------DPDHIITNGSPAYEGQAPYVVGMAF---GQ 50
            ||.|::   |.|..|.||..:.|            |....||.||.|..||.||.||::.   ..
  Fly     1 MKFLII---LALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSAL 62

  Fly    51 SNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYVTGN--------QH 107
            |:.||.|::||.||:||:|.|..|...||:|.|||..:.|:.|.||.:|:.:..:        ..
  Fly    63 SSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTVSSSDIIIHSGWNSANLRND 127

  Fly   108 LALVRVPRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTT-FSNGLTDALQCVDLQIMSNN 171
            ::|:::|....|:|::.|.|||:.|....:....|...|||.|: .|:|:...||.|||.:::|.
  Fly   128 ISLIKIPATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNT 192

  Fly   172 ECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFAR 236
            :|...||::.|:|..||..|...:|||.||:|.||:.|..|..:|:::|.||.||..|.||.|.|
  Fly   193 KCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQIGLTSFGASAGCEKGYPAAFTR 257

  Fly   237 ITSALDWIHQRTGI 250
            :||.||||...|||
  Fly   258 VTSYLDWIKTNTGI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 92/228 (40%)
Tryp_SPc 29..244 CDD:214473 90/226 (40%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 90/227 (40%)
Tryp_SPc 38..268 CDD:238113 92/229 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470884
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.