DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG6462

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:245 Identity:73/245 - (29%)
Similarity:122/245 - (49%) Gaps:27/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAF---GQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQA 90
            |..|..|..|..||.||:..   |...:.|.|::|...::||:|.|||.:....||.|||..:..
  Fly    77 IAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFADV 141

  Fly    91 QFTV---TVGTSEYVT--------GNQHLALVRVPR-VGFSNRVNRVALPSLRNRSQRYENWW-- 141
            :.:|   .|...:::.        |...|||:|:|| |..|.:|..:.|..    ...::|:.  
  Fly   142 EDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAG----EFMHQNFLVG 202

  Fly   142 --ANVCGWG-VTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSD-QILCTRTPSGRSTCFGDA 202
              ..:.||| :...::..|..||.:|.:::....||.::....||. :.|||...:||..|.||:
  Fly   203 KVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGACNGDS 267

  Fly   203 GSPLI--TKQDSTVVGISAFVASNGCTLGLPAGFARITSALDWIHQRTGI 250
            |.|::  .:..|.::|:::|.::.||.:|.|..:.|||:.|.||.|:|.:
  Fly   268 GGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAM 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 71/239 (30%)
Tryp_SPc 29..244 CDD:214473 69/237 (29%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 69/237 (29%)
Tryp_SPc 77..314 CDD:238113 71/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.