DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG10477

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:277 Identity:98/277 - (35%)
Similarity:158/277 - (57%) Gaps:30/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLL-VVFLGLTLVAAGSAKKD--------SEDP--DHIITNGSPAYEGQAPYVVGMAFGQS--N 52
            ||:. |:.|.:..|:|...::|        |..|  |..||||:.|...|.||.||::|..|  :
  Fly     1 MKVFAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGS 65

  Fly    53 IWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYVTGNQH---------- 107
            .||.|:||.:||:||:|.|..|:|.||||:|:|..:.|:....|.:|::|   ||          
  Fly    66 WWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSAKLKKKVSSSKFV---QHAGYNAATLRN 127

  Fly   108 -LALVRVPRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSN-GLTDALQCVDLQIMSN 170
             ::|::.|.|.|:..:|::|||::.:....|....|...|||.|:.|: .:...||....|:::|
  Fly   128 DISLIKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITN 192

  Fly   171 NECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFA 235
            ..|...:||:.|:..::|..:.:.:|||.||:|.||..  ::.::|:::||:|.||....||||.
  Fly   193 AVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLAL--NNRLIGVTSFVSSKGCEKNAPAGFT 255

  Fly   236 RITSALDWIHQRTGIAY 252
            |:||.||||..::|:.|
  Fly   256 RVTSYLDWIKNQSGVFY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 86/230 (37%)
Tryp_SPc 29..244 CDD:214473 84/228 (37%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 84/229 (37%)
Tryp_SPc 40..267 CDD:238113 86/231 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470849
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.