DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG15873

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:289 Identity:72/289 - (24%)
Similarity:112/289 - (38%) Gaps:67/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVVFLGL-----------------------TLVAAGSAKKDSEDPDHIITNGSPAYEGQAPY 42
            |::|.|||||                       .|::.|...|.:....|:::..:..|      
  Fly     1 MQILTVFLGLILSTSLSDADLGVIGDISDETFEMLISGGYKPKSNRLSRHVVSIRTKNY------ 59

  Fly    43 VVGMAFGQSNIWCSGTIIGDTWILTSAQCLT-------GSSGVTIYFG-ATRLS---QAQFTVT- 95
               :.....|.:|||.::....:||:|.|||       ...|:.:.|| .|||:   ::.|... 
  Fly    60 ---VRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVD 121

  Fly    96 --VGTSEYVTGNQH-LALVRVPRVGFSNRV---NRVALPSLRNRSQRYENWWANVC---GWGVTT 151
              |...||....:: ||::|:     |.||   |...||.|..::....  :.:.|   |||...
  Fly   122 RLVVHPEYERYKKNDLAILRL-----SERVQSSNHDVLPLLMRKTANVT--YGDTCITLGWGQIY 179

  Fly   152 FSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGRS-TCFGDAGSPLITKQDSTVV 215
            .....::.|..:|:.:...:.|...| .|..:|..:||. |.|.| .|.||.|.||:.|  ..:.
  Fly   180 QHGPYSNELVYLDVILRPPSLCQKHY-DTFTADHNVCTE-PVGESMNCAGDMGGPLLCK--GALF 240

  Fly   216 GISAFVASNGCTLGLPAGFARITSALDWI 244
            |:..  ...||..|....|.......|||
  Fly   241 GLIG--GHMGCAGGKAMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 61/238 (26%)
Tryp_SPc 29..244 CDD:214473 59/236 (25%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 58/235 (25%)
Tryp_SPc 59..250 CDD:238113 55/212 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.