DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG30283

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:274 Identity:75/274 - (27%)
Similarity:124/274 - (45%) Gaps:41/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVVFLGLTLVAAGS-AKKDSEDPDHI-------------ITNGSPAYEGQAPYVVGMAFGQS 51
            ||...:|:.:.|:||.| ....||....:             |..|..|....||: :.|..|:.
  Fly     1 MKNTKIFVVVVLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPW-MAMVMGEG 64

  Fly    52 NIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGA-TRLSQAQ-FTVT---VGTSEYVTGNQH-LAL 110
            ...|.||:|.:.::||||.|:.... :.:..|. .|.::|| |.|.   |.|..|.  :|| |||
  Fly    65 GFHCGGTLITNRFVLTSAHCIANGE-LKVRLGVLEREAEAQKFAVDAMFVHTDYYF--DQHDLAL 126

  Fly   111 VRV-PRVGFSNRVNRVAL---PSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNN 171
            :|: .||.:|:.::.:.|   |.::|..:....:  ...|||.|. |...:..||...|..:..:
  Fly   127 LRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKF--RTYGWGKTE-SRSSSRMLQKTSLFNLHRS 188

  Fly   172 ECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPL---ITKQDSTVV---GISAFVASNGCTLGL 230
            ||...|....::...:|..: :..:||.||:|.||   :|.....:|   |:::|..:: |:.. 
  Fly   189 ECAKQYPHQQINRNHICAES-ANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHAD-CSKA- 250

  Fly   231 PAGFARITSALDWI 244
             ..|..:.:.||||
  Fly   251 -TVFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 66/232 (28%)
Tryp_SPc 29..244 CDD:214473 64/230 (28%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 64/231 (28%)
Tryp_SPc 43..266 CDD:238113 66/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.