DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and try-9

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:256 Identity:52/256 - (20%)
Similarity:84/256 - (32%) Gaps:85/256 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAFGQSNI--WCSGTIIGDTWILTSA-----------QCLTGSSGVTI 80
            |::||.::...     |..|.::..  ..:||::....|:|:|           .|.||:.....
 Worm     5 ISDGSGSFRNG-----GNKFSENEFVQHGTGTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAY 64

  Fly    81 YFGATRLSQAQFTVTVGTSEYVTGNQH------LAL----VRVPRVG------------------ 117
            :....:...|...||....|...|...      ||:    :|...||                  
 Worm    65 FVRDYKNFVAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELE 129

  Fly   118 ----FSNRVNRVALPSL----RNRSQRYENWWANVCGWG----VTTFSNGLTDAL-----QCVDL 165
                ||..:....|||.    |.|...|:     :.|:|    .:...:|...:|     :|.| 
 Worm   130 EPIEFSKDIFPACLPSAPKIPRIRETGYK-----LFGYGRDPSDSVLESGKLKSLYSFVAECSD- 188

  Fly   166 QIMSNNECIAF-YGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNG 225
                     .| ||.      :.||...:...:|.||:||.::...|:..|.:...|.|.|
 Worm   189 ---------DFPYGG------VYCTSAVNRGLSCDGDSGSGVVRTSDTRNVQVLVGVLSAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 52/256 (20%)
Tryp_SPc 29..244 CDD:214473 52/256 (20%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 47/226 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.