DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and scaf

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:212 Identity:54/212 - (25%)
Similarity:84/212 - (39%) Gaps:42/212 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CSGTIIGDTWILTSAQCLT----------------GSSGVTIYFGATRLSQAQFTVTVGTSEYVT 103
            |.|.||||.::|:||.|:.                ||:...:.|..|.:.    ||.|......:
  Fly   450 CGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVK----TVDVHPDYDPS 510

  Fly   104 GNQH-LALVRVP-RVGFSNRVNRVAL--PSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCV- 163
            .|.| ||::|:. |:.|::.:..:.:  ...::..|.:.:      |||....|.....||..| 
  Fly   511 TNSHDLAIIRLERRLEFASHIQPICISDEDPKDSEQCFTS------GWGKQALSIHEEGALMHVT 569

  Fly   164 DLQIMSNNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTL 228
            |....:.:||.|...|       :|:.|..  .:|..|.||.|.....|:|.....|...|.|..
  Fly   570 DTLPQARSECSADSSS-------VCSATKF--DSCQFDVGSALACGSGSSVRLKGIFAGENSCGE 625

  Fly   229 GLPAGFARITSALDWIH 245
            |....||:  ..:.||:
  Fly   626 GQTVRFAK--PDIKWIN 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 54/212 (25%)
Tryp_SPc 29..244 CDD:214473 52/209 (25%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 46/184 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435397
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.