DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG9377

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:203 Identity:45/203 - (22%)
Similarity:74/203 - (36%) Gaps:42/203 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQA--------QFTV 94
            |:.|::|.: :|.....|||.:|....::|:|.|:..|....:...|.....|        |...
  Fly   110 GEFPWLVAV-YGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRS 173

  Fly    95 TVGTSEYVTGNQ-----HLALVRVPR---VGFSNRVNRVALPSLR---NRSQRYENWWANVCGWG 148
            .|.|..:....|     ::|::.|.:   ...:..|..:.||..|   |.||.|      |.||.
  Fly   174 VVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQCY------VSGWQ 232

  Fly   149 VTTFSNGLTDALQCVDLQIMSNNEC-----IAFYGSTTV-SDQILCTRTPSGRSTCFGDAGSPLI 207
            .:.|........:.. |.::..::|     ::..|.... :|.:||.....|...| ||.     
  Fly   233 RSDFGRAAILPKRWT-LYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVC-GDV----- 290

  Fly   208 TKQDSTVV 215
               |.|.|
  Fly   291 ---DMTAV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 45/203 (22%)
Tryp_SPc 29..244 CDD:214473 45/203 (22%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 45/203 (22%)
Tryp_SPc 105..339 CDD:214473 45/203 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.