DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and PRSS48

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:250 Identity:60/250 - (24%)
Similarity:100/250 - (40%) Gaps:47/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLT---GSSGVTIYFGATRLSQA 90
            :..|..|..|:.|:.|.:.| ..|..|.|:::.:..|||:|.|:.   .:...|::.|       
Human    51 VVGGQDAAAGRWPWQVSLHF-DHNFICGGSLVSERLILTAAHCIQPTWTTFSYTVWLG------- 107

  Fly    91 QFTVTVGTS---------------EYVTGNQHLALVRV-PRVGFSNRVNRVALPSLRNRSQRYEN 139
              ::|||.|               :|......:||::: .:|.|::.:..:.|||:..:......
Human   108 --SITVGDSRKRVKYYVSKIVIHPKYQDTTADVALLKLSSQVTFTSAILPICLPSVTKQLAIPPF 170

  Fly   140 WWANVCGWGVTTFSN--GLTDALQCVDLQIMSNNECIAFYGSTTV----------SDQILCTRTP 192
            .|  |.|||....|:  ....|||..::.|:....|...|....:          .|:|....|.
Human   171 CW--VTGWGKVKESSDRDYHSALQEAEVPIIDRQACEQLYNPIGIFLPALEPVIKEDKICAGDTQ 233

  Fly   193 SGRSTCFGDAGSPLITKQDSTVVGISAFVASNG--CTLGLPAGFARITSALDWIH 245
            :.:.:|.||:|.||....|.  |.|...|.|.|  |...||..:..:.....||:
Human   234 NMKDSCKGDSGGPLSCHIDG--VWIQTGVVSWGLECGKSLPGVYTNVIYYQKWIN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 60/249 (24%)
Tryp_SPc 29..244 CDD:214473 58/247 (23%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 58/247 (23%)
Tryp_SPc 51..288 CDD:238113 60/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.