DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:259 Identity:123/259 - (47%)
Similarity:155/259 - (59%) Gaps:15/259 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VFLGLTLVAAGSAK--------KDSEDPDHI---ITNGSPAYEGQAPYVVGMAFGQSNIWCSGTI 59
            |||.:..:|..||.        ||......|   ||||..|.||:|||.||:.| ....||.|:|
  Fly     3 VFLAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGF-SGGWWCGGSI 66

  Fly    60 IGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYVT-GNQHLALVRVPRVGFSNRVN 123
            |...|:||:..|:..::.|.:|||||..:.||||.|||...::. .|..:||:|:|.|.|.:.||
  Fly    67 IAHDWVLTAEHCIGDAASVIVYFGATWRTNAQFTHTVGNGNFIKHSNADIALIRIPHVDFWHMVN 131

  Fly   124 RVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILC 188
            :|.|||..:|...|..|||..||||.|...:.|.|.||||||||:.|.||...|||  |.|.::|
  Fly   132 KVELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYGS--VGDNVIC 194

  Fly   189 TRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARITSALDWIHQRTGIAY 252
            |||..|:|.|.||:|.||:|...|.:||:|.||:||||..|.||||.|:|..||||...|||:|
  Fly   195 TRTVDGKSICGGDSGGPLVTHDGSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIRDHTGISY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 110/217 (51%)
Tryp_SPc 29..244 CDD:214473 108/215 (50%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 108/216 (50%)
Tryp_SPc 37..253 CDD:238113 110/218 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470805
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.