DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Prss34

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:246 Identity:69/246 - (28%)
Similarity:108/246 - (43%) Gaps:33/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAF--GQSNIW---CSGTIIGDTWILTSAQCL----TGSSGVTIYFGA 84
            |..|.|....:.|:.|.:..  .:.:.|   |.|::|...|:||:|.|:    ..:.||.:..|.
Mouse    35 IVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCVRPKEVEAYGVRVQVGQ 99

  Fly    85 TRLSQAQFTVTV-------GTSEYVT--GNQHLALVRV-PRVGFSNRVNRVALPSLRNRSQRYEN 139
            .||.:....:.|       ..||.::  |...:||::: .||..|..|..|:||:...|....:.
Mouse   100 LRLYENDQLMKVVKIIRHPKFSEKLSARGGADIALLKLDTRVVLSEHVYPVSLPAASLRISSKKT 164

  Fly   140 WWANVCGWGVTTFSNGLTDA--LQCVDLQIMSNNECIAFY------GSTT--VSDQILCTRTPSG 194
            .|  |.||||......|...  |:.|.:.|:.||:|...|      .|||  :.|.:||. ...|
Mouse   165 CW--VAGWGVIENYMPLPPPYHLREVAVPIVENNDCEQKYQTNSSSDSTTRIIKDDMLCA-GKEG 226

  Fly   195 RSTCFGDAGSPLITKQDSTVVGISAFVASNGCTL-GLPAGFARITSALDWI 244
            |.:|..|:|.||:.:.:.:.|.:.......||.| ..|..:.|:.|.:.||
Mouse   227 RDSCKADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYVSWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 69/246 (28%)
Tryp_SPc 29..244 CDD:214473 67/244 (27%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 69/246 (28%)
Tryp_SPc 35..277 CDD:214473 67/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.