DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Hayan

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:268 Identity:62/268 - (23%)
Similarity:108/268 - (40%) Gaps:61/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HIITNGSPAYEGQAPYVVGMA---FGQSNIWCSGTIIGDTWILTSAQCLTG--SSGVTIYFGATR 86
            ||: :|.....|..|::..:|   ||.:...|.|::|...::||:|.|:..  |:...:..||..
  Fly   384 HIL-DGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALN 447

  Fly    87 LSQAQFTVTVGTSEYVTGNQHLALVRV---PRVGFSNRVNRVALPSL----------------RN 132
            :...:           .|.|.:.::.|   |....|::...:|:..|                .:
  Fly   448 IENPE-----------PGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTD 501

  Fly   133 RSQRYENWWANVCGWGVTTFSN-GLTDALQCVDLQIMSNNECIAFYGST----------TVSDQI 186
            ||....|:...|.||||...:| .::..|....|.::..:||.|.:...          .::.|:
  Fly   502 RSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQL 566

  Fly   187 LCTRTPSGRSTCFGDAGSPLITKQDS-----TVVGI--SAFVASNGCTLGLPAGFARITSALDWI 244
            ........:..|.||:|.|||.:.|.     ::||:  |.|    ||....|..:.|::|.||:|
  Fly   567 CAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGF----GCATKTPGLYTRVSSFLDYI 627

  Fly   245 HQRTGIAY 252
            .   ||.:
  Fly   628 E---GIVW 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 58/258 (22%)
Tryp_SPc 29..244 CDD:214473 57/256 (22%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 59/258 (23%)
Tryp_SPc 385..630 CDD:238113 59/263 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437018
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.