DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG31220

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:229 Identity:52/229 - (22%)
Similarity:89/229 - (38%) Gaps:41/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CSGTIIGDTWILTSAQCLTG----------------------SSGVTIYFGATRLSQAQFTVTVG 97
            |.|::|...::||:|.|:|.                      |.|..|....|.|.....::| .
  Fly   139 CGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESIT-S 202

  Fly    98 TSEYVTGN----QHLALVRVPR-VGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLT 157
            .::|...|    ..:||||:.. |.::.....:.:........:::.:   |.|||.|...:..:
  Fly   203 HNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMY---VAGWGKTGMFDTGS 264

  Fly   158 DALQCVDLQIMSNNECIAFYGSTTVSDQI-LCTRTPSGRSTCFGDAGSPLITKQDST------VV 215
            ..|:...:::....||...|.......:. :|......|.||.||:||||:.....:      :.
  Fly   265 KVLKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLA 329

  Fly   216 GISAFVASNGCTLGLPAGFARITSALDWI--HQR 247
            ||:::....| |:|.|:.|.|......||  |.|
  Fly   330 GITSYGGPCG-TIGWPSVFTRTAKFYKWIRAHLR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 50/226 (22%)
Tryp_SPc 29..244 CDD:214473 48/222 (22%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 48/222 (22%)
Tryp_SPc 104..360 CDD:238113 50/225 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.