DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG11664

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:256 Identity:53/256 - (20%)
Similarity:95/256 - (37%) Gaps:59/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVVFLGLTLVAAGSAKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWI 65
            |..:|..|.|.|:|......|:      :..|.|..:....||: ..:|...: .:|::....::
  Fly     1 MTAVVESLQLILLAIAVRWGDA------LHRGIPVQQQNYGYVM-QIYGPQFL-AAGSLFSARYV 57

  Fly    66 LTSAQCL---TGSSGVTIYFG-------------ATRLSQAQFTVTVGTSEYVTGNQHLALVRV- 113
            ||.|.|.   |....:::..|             |..|...:|:.       :|....:|::|| 
  Fly    58 LTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQVAGLLRHPKFSP-------LTLRNDIAVLRVK 115

  Fly   114 PRVGFSNRVNRVALPSLRNRSQRYENWWA---NVCGWGVTTFSNGLTDALQCVDLQIMSNNECIA 175
            ..:..|:.:|.:.|.|   |.....|.:|   .:.||.:.    .:...|:.:.:|:.....|..
  Fly   116 AAISHSHMINYIGLCS---RPLTPLNMFAPPQELAGWNLM----HIAQPLKSMSVQVEPEKNCRQ 173

  Fly   176 FYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFAR 236
            ::  ..:|..::|.....|...|:||:|.|||               |.|...||...|.:
  Fly   174 WF--PQISGGVICASATMGEGLCYGDSGDPLI---------------SGGEVCGLAIAFRK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 46/228 (20%)
Tryp_SPc 29..244 CDD:214473 46/228 (20%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 42/213 (20%)
Tryp_SPc 38..237 CDD:214473 42/213 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.