DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Prss30

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:278 Identity:70/278 - (25%)
Similarity:116/278 - (41%) Gaps:46/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GLTLVAA-------GSAKKD--------SEDPDHIITNGSPAYEGQAPYVVGMAFGQSNIWCSGT 58
            ||||..:       |.|:.|        |.|...|: .|..|.|||.|:.|.:...:....|.|:
Mouse    40 GLTLRRSYAGFFYNGWARGDILPSVCGHSRDAGKIV-GGQDALEGQWPWQVSLWITEDGHICGGS 103

  Fly    59 IIGDTWILTSAQCLTGSSGVTIY---FGATRLS--QAQFTVTVGTSEYV--------TGNQHLAL 110
            :|.:.|:||:|.|...|...:.|   .|...||  :...|:....:.:|        ..:..:||
Mouse   104 LIHEVWVLTAAHCFRRSLNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIAL 168

  Fly   111 VRVPRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIA 175
            |::......::...|.||:.:.........|  |.|||.|. ...:...||.:.:.::.:.:|..
Mouse   169 VQLDTPLRPSQFTPVCLPAAQTPLTPGTVCW--VTGWGATQ-ERDMASVLQELAVPLLDSEDCEK 230

  Fly   176 FY--------GSTTVSDQILCTRTPSG-RSTCFGDAGSPLITKQDS--TVVGISAFVASNGCTLG 229
            .|        |...:...:||.....| :.:|.||:|.||:...:|  |.|||:::  ..||...
Mouse   231 MYHTQGSSLSGERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSW--GIGCARP 293

  Fly   230 L-PAGFARITSALDWIHQ 246
            . |..:.|:.:.:|||.:
Mouse   294 YRPGVYTRVPTYVDWIQR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 60/241 (25%)
Tryp_SPc 29..244 CDD:214473 58/239 (24%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 61/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.