DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Mcpt2

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:260 Identity:62/260 - (23%)
Similarity:109/260 - (41%) Gaps:35/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVVFLGLTLVAAGSAKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQS---NIWCSGTIIGD 62
            |:.|:..:.|.|.:...|::        |..|..:.....||:..:.....   .:.|.|.:|..
  Rat     1 MQALLFLMALLLPSGAGAEE--------IIGGVESIPHSRPYMAHLDIVTEKGLRVICGGFLISR 57

  Fly    63 TWILTSAQCLTGSSGVTIYFGATRLSQAQFT--------VTVGTSEYVTGNQH-LALVRV-PRVG 117
            .::||:|.|  ....:|:..||..:.:.:.|        ..:..|.....|.| :.|::: .:|.
  Rat    58 QFVLTAAHC--KGREITVILGAHDVRKRESTQQKIKVEKQIIHESYNSVPNLHDIMLLKLEKKVE 120

  Fly   118 FSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTV 182
            .:..||.|.|||..:........||  .|||.|...:..:..|:.|:|:||....|:. |.....
  Rat   121 LTPAVNVVPLPSPSDFIHPGAMCWA--AGWGKTGVRDPTSYTLREVELRIMDEKACVD-YRYYEY 182

  Fly   183 SDQILCTRTPSG-RSTCFGDAGSPLITKQDSTVVGISAFVASNG-CTLGLPAGFARITSALDWIH 245
            ..|: |..:|:. |:...||:|.||:      ..|::..:.|.| .....||.|.|:::.:.||:
  Rat   183 KFQV-CVGSPTTLRAAFMGDSGGPLL------CAGVAHGIVSYGHPDAKPPAIFTRVSTYVPWIN 240

  Fly   246  245
              Rat   241  240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 57/232 (25%)
Tryp_SPc 29..244 CDD:214473 55/229 (24%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 55/238 (23%)
Tryp_SPc 21..242 CDD:238113 57/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.