DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Prss27

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:244 Identity:69/244 - (28%)
Similarity:108/244 - (44%) Gaps:30/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIY---FGATRLSQA 90
            :..|..|.||:.|:.|.:....:: :|.|::|..||:||:|.|.:.:|.::||   .||.:|.|.
  Rat    38 MVGGEDALEGEWPWQVSIQRNGAH-FCGGSLIAPTWVLTAAHCFSNTSDISIYQVLLGALKLQQP 101

  Fly    91 ---QFTVTV----GTSEY--VTGNQHLALV--RVPRVGFSNRVNRVALPSLRNRSQRYENWWANV 144
               ...|.|    ...||  :..:..:|||  :|| |.|:..:..|.||......:...|.|  |
  Rat   102 GPHALYVPVKRVKSHPEYQGMASSADVALVELQVP-VTFTKYILPVCLPDPSVVFKSGMNCW--V 163

  Fly   145 CGWGVTTFSNGLTD--ALQCVDLQIMSNNECIAFYGS--------TTVSDQILCTRTPSG-RSTC 198
            .|||..:..:.|.:  .||.:.:.::...:|...|..        .|:.|.:||.....| :..|
  Rat   164 TGWGSPSEQDRLPNPRILQKLAVPLIDTPKCNLLYSKDAEADIQLKTIKDDMLCAGFAEGKKDAC 228

  Fly   199 FGDAGSPLITKQDSTVVGISAFVASNGCT-LGLPAGFARITSALDWIHQ 246
            .||:|.||:...|.:.|.........||. ...|..:.|:.|...||||
  Rat   229 KGDSGGPLVCLVDQSWVQAGVISWGEGCARRNRPGVYIRVASHYQWIHQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 67/242 (28%)
Tryp_SPc 29..244 CDD:214473 65/240 (27%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 65/240 (27%)
Tryp_SPc 39..278 CDD:238113 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.