DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG33461

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:298 Identity:67/298 - (22%)
Similarity:116/298 - (38%) Gaps:74/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVVFLGLTLVAA-GSAKKDSEDP-------DHIITNGSPAYEGQAPYVVGMAFGQSNIW--C 55
            ||.::.:|.|.::.. ||:....|:.       .:.|.||:||..|:.|:   |||..:..:  |
  Fly     6 MKTIIAYLALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPW---MAFLHTPTYFLC 67

  Fly    56 SGTIIGDTWILTSAQCLTGSSGVTIYFGA-----------TRLSQAQFTVTVGTSEYVTG----- 104
            :|::|...::||||.|:.....:....|.           .|..:|       |.||...     
  Fly    68 AGSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEA-------TQEYNVDMLFKH 125

  Fly   105 --------NQHLALVRVP-RVGFSNRVNRVALPSLRNRSQRY---ENWWANVCGWGVTTFSNGLT 157
                    :..:.::|:. ||.::..:..:.:  ..:|..:.   :..|....|||:|:     |
  Fly   126 RLYDPKDFSNDIGMLRLERRVEYTYHIQPICI--FHHRRMQLVVDQITWFKATGWGLTS-----T 183

  Fly   158 D-------ALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSP-----LITKQ 210
            |       .|..::|.....|:|...:....:|.|| |.....| :.|.||:|.|     ||...
  Fly   184 DLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQI-CAGNDDG-NLCRGDSGGPQGRYVLIFGM 246

  Fly   211 DSTV-VGISAFVASNGCTLGLPAGFAR----ITSALDW 243
            ...| :||::|...|...:.:.....|    |...:||
  Fly   247 KRFVQMGIASFTYENCSKVSILTDVVRYGRWIKKVVDW 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 60/262 (23%)
Tryp_SPc 29..244 CDD:214473 60/262 (23%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 57/255 (22%)
Tryp_SPc 42..281 CDD:238113 58/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436109
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.