DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Sp212

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:278 Identity:54/278 - (19%)
Similarity:107/278 - (38%) Gaps:67/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTLVAAGSAKKDSEDPDHIITNGSPAYEGQAPY--------VVGMAFGQSNIWCSGTIIGDTWIL 66
            ::.|..|  ::.|..|  .|..|:....||.|:        |..:||.     |.|::|..:.::
  Fly   262 ISSVVCG--REGSTTP--FIVRGNEFPRGQYPWLSAVYHKEVRALAFK-----CRGSLISSSIVI 317

  Fly    67 TSAQCLTGSSGVTIYFGATRLSQAQFTVTVG---------------------------TSEYVTG 104
            ::|.|:            .|:::.:..|.:|                           |..|  .
  Fly   318 SAAHCV------------HRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSY--S 368

  Fly   105 NQHLALVRVPR-VGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIM 168
            :..:||:.:.| |.|::.:..:.:.::  .:.|..:....:.|||....|: .|...:.|:.:|.
  Fly   369 DADIALITIERPVTFNDIIAPICMWTV--EASRTVSTTGFIAGWGRDEDSS-RTQYPRVVEAEIA 430

  Fly   169 SNNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDST-----VVGISAFVASNGCTL 228
            |...|.:.:..|.|:::.||.....|...|.||:|..|:.||...     :|.......:..|.|
  Fly   431 SPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQL 495

  Fly   229 GLPAGFARITSALDWIHQ 246
            .....:..::..::||.:
  Fly   496 NQYVLYCDLSKHINWISE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 50/257 (19%)
Tryp_SPc 29..244 CDD:214473 48/255 (19%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 50/259 (19%)
Tryp_SPc 277..511 CDD:214473 48/255 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.