DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and TPSG1

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:253 Identity:61/253 - (24%)
Similarity:101/253 - (39%) Gaps:32/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GSAKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLTG---SSG 77
            |..:....|....|..|..|..|..|:...:...:.:: |.|:::...|:||:|.|.:|   ||.
Human    50 GCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRVHV-CGGSLLSPQWVLTAAHCFSGSLNSSD 113

  Fly    78 VTIYFGATRLSQAQFTVTV-------------GTSEYVTGNQHLALVRVPRVGFSNRVNRVALPS 129
            ..::.|...::.:....||             |||    |:..|..:.|| |..|:|:..|.||.
Human   114 YQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTS----GDIALVELSVP-VTLSSRILPVCLPE 173

  Fly   130 LRNRSQRYENWWANVCGWGVTTFSNGLTD--ALQCVDLQIMSNNECIAFY---GSTTVSDQILCT 189
            ..:........|  |.|||.|.....|..  :|:.|.:.::....|...|   |.:.:...:||.
Human   174 ASDDFCPGIRCW--VTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCA 236

  Fly   190 RTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGC-TLGLPAGFARITSALDWIHQ 246
            |.|.  ..|..|:|.||:.:.:...|.........|| ....|..:.|:.:.::||.:
Human   237 RGPG--DACQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 59/238 (25%)
Tryp_SPc 29..244 CDD:214473 57/236 (24%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 57/237 (24%)
Tryp_SPc 63..293 CDD:238113 59/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.