DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG30323

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:211 Identity:47/211 - (22%)
Similarity:77/211 - (36%) Gaps:57/211 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NIWCSGTIIGDTWILTSAQCLTGSSGVT------------IYFGATRLSQA------QFTVTVGT 98
            |.:|:|:::...|::||..|::.....|            :.|...||.:.      .....|..
  Fly    51 NHFCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIVLD 115

  Fly    99 SEYVTGNQHLALVRVPRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWG--------------- 148
            ...::|...|||:::.| |.:.:...:.||.....|    .|..|..|||               
  Fly   116 ESAISGCTELALLKLDR-GVTGQRFAMMLPEKELNS----TWLCNSLGWGRIYYVSYVYISAMCP 175

  Fly   149 ---------VTTFSNG-LTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGR-STCFGDA 202
                     ||.|.:| .:..|..:..|.:|..||      .....:.||..:.:|| :.|..|.
  Fly   176 AFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYEC------KPDCSRCLCMTSYTGRGNMCQQDL 234

  Fly   203 GSPLITKQDSTVVGIS 218
            ||||..  |..:.|::
  Fly   235 GSPLFC--DHFLYGVA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 47/211 (22%)
Tryp_SPc 29..244 CDD:214473 47/211 (22%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 47/211 (22%)
Tryp_SPc 45..272 CDD:214473 47/211 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471255
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.