DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG30098

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:213 Identity:49/213 - (23%)
Similarity:92/213 - (43%) Gaps:36/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CSGTIIGDTWILTSAQCLTGSSGVTIYFG---ATRLSQAQF----TVTV-GTSEYVTGNQH-LAL 110
            |.|::|...::||:|.|...:..:.:..|   ::|.:..|.    .|:: ....|:....| :|:
  Fly    60 CGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYIDFRNHDIAV 124

  Fly   111 VRVPR-VGFSNRVNRV------ALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIM 168
            :::.| |.:...:..:      .|.||.|..|.:     .:.|||.......:...||.:.|:.:
  Fly   125 LKLDRQVVYDAYIRPICILLNSGLQSLANSIQNF-----TLTGWGQMAHYYKMPTTLQEMSLRRV 184

  Fly   169 SNNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPL--ITKQDSTVVGISAFVASNGCTLGLP 231
            .|..|    |..::|   :|...|. :..||||:|.||  :.|.....:.:. |..:|..| |..
  Fly   185 RNEYC----GVPSLS---ICCWNPV-QYACFGDSGGPLGSLVKYGHKTIYVQ-FGVTNSVT-GNC 239

  Fly   232 AGFAR---ITSALDWIHQ 246
            .|::.   :.|.:.|::|
  Fly   240 DGYSSYLDLMSYMPWLYQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 48/211 (23%)
Tryp_SPc 29..244 CDD:214473 47/209 (22%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 47/208 (23%)
Tryp_SPc 37..258 CDD:238113 49/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436117
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.