DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG30090

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:251 Identity:61/251 - (24%)
Similarity:101/251 - (40%) Gaps:52/251 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAFGQSNI--WCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQ 91
            |..|..|.....|:   ||:..|::  .|.||:|...::||:|.|:...|.|.:     ||.:..
  Fly    40 IIGGRDAIINSNPW---MAYIHSSVKLICGGTLITQRFVLTAAHCVNEGSAVKV-----RLGEYD 96

  Fly    92 FTVTVGTSEYV---TGNQH-------------------LALVRVPR-VGFSNRVNRVAL---PSL 130
            .|.|...:..:   ...:|                   :||:|:.: |.|...::.:.:   .|.
  Fly    97 DTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSK 161

  Fly   131 RNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGR 195
            |......|  |....|||.|. ::.....||...||..::::|:...|.....:||...|.  |.
  Fly   162 RELVDSIE--WFVATGWGETR-THRTRGVLQITQLQRYNSSQCMQALGRLVQQNQICAGRL--GS 221

  Fly   196 STCFGDAGSPL------ITKQDSTVVGISAFVASNGCT-LGLPAGFARITSALDWI 244
            .||.||:|.||      :.|......|:.:: .|..|: :|:   :..:.|..|||
  Fly   222 DTCNGDSGGPLFQTVRHMDKMRPVQFGVVSY-GSRECSGIGV---YTDVYSYADWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 61/251 (24%)
Tryp_SPc 29..244 CDD:214473 59/249 (24%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 59/249 (24%)
Tryp_SPc 40..276 CDD:238113 61/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.