DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG30087

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:256 Identity:60/256 - (23%)
Similarity:95/256 - (37%) Gaps:63/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFT 93
            :.||..|....||::|.:. ..|...|.|:|:...:|||:|.|:         |...||...:..
  Fly    42 VVNGKEAVIRSAPFMVYVT-NNSLTHCGGSILNSRYILTAAHCV---------FPNLRLRLGEHN 96

  Fly    94 VTV----------------GTSEYVTGNQHLALVRVPRVGFSNRVNRVALPSLRNRSQRYENWWA 142
            :..                |..:.:|...:.|         :|.||.:||..| |||..:.....
  Fly    97 IRTDPDCQGSNCSPRSEEYGIMKAITHRFYNA---------ANHVNDIALLKL-NRSINFNVHIQ 151

  Fly   143 NVC-----------------GWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTR 190
            .:|                 |||.|. .||....||..:|:......|...:.:....:||....
  Fly   152 PICILLNPASAPSVATYQTFGWGETK-KNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQICAGH 215

  Fly   191 TPSGRSTCFGDAGSPLITKQDSTVVGISAF----VASNGCT-LGLPAGFARITSALDWIHQ 246
              ..|.||.||:|.||:|:.|..  |:..:    :.|.|.| ...|..:..:.:.::||.:
  Fly   216 --EERDTCAGDSGGPLVTRVDFD--GVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWIRR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 60/254 (24%)
Tryp_SPc 29..244 CDD:214473 58/252 (23%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 58/252 (23%)
Tryp_SPc 42..272 CDD:238113 60/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.