DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG30083

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:241 Identity:60/241 - (24%)
Similarity:105/241 - (43%) Gaps:44/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAF-------GQSNIWCSGTIIGDTWILTSAQCL---------TGSSG 77
            |.:|..|..|..|:   ||:       ..:.:.|.||:|...::|::|.|:         .|...
  Fly    34 IMHGQNAENGTNPW---MAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILAVRLGEHS 95

  Fly    78 VTIYFGATRLSQAQFTVTVGTSEYVTG--NQHLALVRV-PRVGFSNRVNRVALPSLRNRSQRYEN 139
            .:.||..|:..:.::        :.||  :..:.::|: |.|.|:..:..:.:.:...:....:.
  Fly    96 SSRYFAVTKAFRNKY--------FTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKT 152

  Fly   140 WWANVCGWGVT---TFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGRSTCFGD 201
            :.|  .|||.|   |||.    .|:.|:|..::.:||...........|| |...|.| .||.||
  Fly   153 FKA--AGWGKTENETFSK----VLKTVELNELNASECYNMLWVNVTESQI-CAGHPDG-DTCAGD 209

  Fly   202 AGSPLI--TKQDSTVVGISAFVASNGCTL-GLPAGFARITSALDWI 244
            :|.|||  ...|.::..:...:.|.|.:| ..|..:.|::|.:|||
  Fly   210 SGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 60/241 (25%)
Tryp_SPc 29..244 CDD:214473 58/239 (24%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 58/239 (24%)
Tryp_SPc 34..255 CDD:238113 58/239 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.