DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG30082

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:266 Identity:61/266 - (22%)
Similarity:95/266 - (35%) Gaps:76/266 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDHIITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFG----AT 85
            |.:.|..|..|..|..|::..: ...|::.|:||:|...::||:|.||.....:|:..|    :|
  Fly    36 PTNRIVGGRTADIGSNPWLAYL-HKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTST 99

  Fly    86 RLS-QAQFTVTVGTSEYVTGNQHLALVRVPRVGFSNRVNRVAL------------------PSLR 131
            |:. .::|.:.. ..||...|.::......|....|.:..:.|                  |...
  Fly   100 RIDCTSEFCIPT-YEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQV 163

  Fly   132 NRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGR- 195
            ..|..||     ..|||.....|..| .||.|:|..:..::|          ::.|.|....|: 
  Fly   164 PYSSTYE-----AAGWGKIDLINTAT-VLQTVNLIRLDQSDC----------ERSLRTSLSYGQF 212

  Fly   196 -------STCFGDAGSPLITKQDSTVVGISAFVASNG-----CTLGL----------PAGFARIT 238
                   .||.||:|.||..|.            |||     ..||:          |..:..:.
  Fly   213 CAGQWRADTCSGDSGGPLSRKM------------SNGRITRTVQLGIVSYGHYLCRGPGVYTYVP 265

  Fly   239 SALDWI 244
            |..:||
  Fly   266 SFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 60/262 (23%)
Tryp_SPc 29..244 CDD:214473 58/260 (22%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 58/261 (22%)
Tryp_SPc 40..274 CDD:238113 60/262 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436107
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.