DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Klk1b3

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:277 Identity:71/277 - (25%)
Similarity:116/277 - (41%) Gaps:53/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVVFLGLTLVAAGSAKKDSEDP-DHIITNGSPAYEGQAPYVVGM-AFGQSNIWCSGTIIGDT 63
            |..|::||.|:|     .:.|:..| ...:..|........|:.|.: .||:  ..|.|.:|..:
  Rat     5 MWFLILFLALSL-----GRNDAAPPVQSRVVGGYNCEMNSQPWQVAVYYFGE--YLCGGVLIDPS 62

  Fly    64 WILTSAQCLTGSSGVTIYFGATRLSQ----AQFTVTVGTSEYVTGNQHLAL--VRVPRVGFSN-- 120
            |::|:|.|.|  ....::.|...|.:    ||..:...:..:...||.|..  .|.|...:||  
  Rat    63 WVITAAHCAT--DNYQVWLGRNNLYEDEPFAQHRLVSQSFPHPGFNQDLIWNHTRQPGDDYSNDL 125

  Fly   121 -------------RVNRVALPSLRNRSQRYENWWANVC---GWG-VTTFSNGLTDALQCVDLQIM 168
                         .|..:.||.       .|....:.|   ||| :|.....|:|.||||::.::
  Rat   126 MLLHLSQPADITDGVKVIDLPI-------EEPKVGSTCLASGWGSITPDGLELSDDLQCVNIDLL 183

  Fly   169 SNNECIAFYGSTTVSDQILCT-RTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLG--- 229
            ||.:|:..: ...|:|.:||. ....|:.||.||:|.|||.  :..:.||::: ..|.|  |   
  Rat   184 SNEKCVEAH-KEEVTDLMLCAGEMDGGKDTCKGDSGGPLIC--NGVLQGITSW-GFNPC--GEPK 242

  Fly   230 LPAGFARITSALDWIHQ 246
            .|..:.::.....||.:
  Rat   243 KPGIYTKLIKFTPWIKE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 63/246 (26%)
Tryp_SPc 29..244 CDD:214473 61/244 (25%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 61/245 (25%)
Tryp_SPc 29..260 CDD:238113 63/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.