DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and F9

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:250 Identity:57/250 - (22%)
Similarity:111/250 - (44%) Gaps:48/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFT 93
            :..|..|..||.|:.| :..|:.:.:|.|:|:.:.||:|:|.|:.....:|:..|...:.:.:.|
Human   227 VVGGEDAKPGQFPWQV-VLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEETEHT 290

  Fly    94 VTVGTSEYVTGNQHLALVR-VPRVGFSNRVNR----VAL-----PSLRN--------RSQRYENW 140
                       .|...::| :|...::..:|:    :||     |.:.|        ..:.|.|.
Human   291 -----------EQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNI 344

  Fly   141 WAN-----VCGWGVTTFSNGLTD-ALQCVDLQIMSNNECIAFYGST--TVSDQILCTR-TPSGRS 196
            :..     |.||| ..|..|.:. .||.:.:.::....|:.   ||  |:.:.:.|.. ...||.
Human   345 FLKFGSGYVSGWG-RVFHKGRSALVLQYLRVPLVDRATCLR---STKFTIYNNMFCAGFHEGGRD 405

  Fly   197 TCFGDAGSPLITKQDST--VVGISAFVASNGCTL-GLPAGFARITSALDWIHQRT 248
            :|.||:|.|.:|:.:.|  :.||.::  ...|.: |....:.:::..::||.::|
Human   406 SCQGDSGGPHVTEVEGTSFLTGIISW--GEECAMKGKYGIYTKVSRYVNWIKEKT 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 56/246 (23%)
Tryp_SPc 29..244 CDD:214473 54/244 (22%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:317114
Tryp_SPc 227..457 CDD:238113 56/247 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.