DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and try-10

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:226 Identity:46/226 - (20%)
Similarity:73/226 - (32%) Gaps:80/226 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVT-------VGTSEYVTGNQ 106
            |.:|: |.|.:|..:.::|||.|:              .|...|.||       |..:::..|.|
 Worm    99 GTTNV-CGGVLIAPSIVITSAHCV--------------FSGDDFAVTAKVTLGDVHLNKHDDGEQ 148

  Fly   107 H----------------------------------------LALVRVPRVGFSNRVNRVALPSLR 131
            .                                        |.:.::|..|..|......|..| 
 Worm   149 EFRSHAMAISKKFFNDASEANDDVAVIFLPQRADVCHSPLSLQIAKLPSTGSVNFKETAPLTQL- 212

  Fly   132 NRSQRYENWWANVCGWGVTTFSNG-LTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGR 195
                :.|.....|.|||.|..... .:|:::    |:|.|.. :...|..    :.|..:..:|.
 Worm   213 ----QLETSVCYVAGWGKTENKTAKYSDSVR----QMMVNLS-VRRIGKR----KYLIAKAVTGS 264

  Fly   196 S-TCFGDAGSPL--ITKQDSTVVGISAFVAS 223
            | .|.||:|||:  .......:||..|.:.|
 Worm   265 SRACMGDSGSPVYCFVNGKRILVGTVAHIGS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 46/226 (20%)
Tryp_SPc 29..244 CDD:214473 46/226 (20%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 44/219 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.