DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Tpsb2

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:283 Identity:81/283 - (28%)
Similarity:120/283 - (42%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLLVVFLGLTLVAA--GSAKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQSNIW---CSGTIIG 61
            :||::...|:|:|:  .||.:.:.....|: .|..|.|.:.|:.|.:.| :.|.|   |.|::|.
Mouse     4 RLLLLLWALSLLASLVYSAPRPANQRVGIV-GGHEASESKWPWQVSLRF-KLNYWIHFCGGSLIH 66

  Fly    62 DTWILTSAQCLTGSSGVTI---------------YFGATRLSQAQFTVTVGTSEYVT--GNQHLA 109
            ..|:||:|.|:    |..|               |:|...||..:..|   ...|.|  |...:|
Mouse    67 PQWVLTAAHCV----GPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVV---HPHYYTAEGGADVA 124

  Fly   110 L--VRVPRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTD--ALQCVDLQIMSN 170
            |  :.|| |..|..::.::||..........:.|  |.|||.......|..  .|:.|.:.|:.|
Mouse   125 LLELEVP-VNVSTHLHPISLPPASETFPPGTSCW--VTGWGDIDNDEPLPPPYPLKQVKVPIVEN 186

  Fly   171 NECIAFY--GSTT------VSDQILC---TRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASN 224
            :.|...|  |..|      |.|.:||   ||    |.:|.||:|.||:.|...|.:.........
Mouse   187 SLCDRKYHTGLYTGDDFPIVHDGMLCAGNTR----RDSCQGDSGGPLVCKVKGTWLQAGVVSWGE 247

  Fly   225 GCTL-GLPAGFARITSALDWIHQ 246
            ||.. ..|..:.|:|..|||||:
Mouse   248 GCAQPNKPGIYTRVTYYLDWIHR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 72/252 (29%)
Tryp_SPc 29..244 CDD:214473 70/250 (28%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.