DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CTRL

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:270 Identity:73/270 - (27%)
Similarity:129/270 - (47%) Gaps:27/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVVFLGLTLVAAGS-------AKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQSNIWCSGTII 60
            :|::.|.|:||..||       |.|.:......|.||..|..|..|:.|.:.......:|.|::|
Human     1 MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLI 65

  Fly    61 GDTWILTSAQCLTGSSGVTIYFGA-TRLSQAQFTVTVGTSEYVTG--------NQHLALVRVPR- 115
            ..:|::|:|.|........:..|. .|.|.|:....:..|..:|.        |..:.|:::.. 
Human    66 SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASP 130

  Fly   116 VGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDA-LQCVDLQIMSNNECIAFYGS 179
            ..::.|::.|.|.|  :.....|.......|||..:....:|.| ||.|.|.:::.|:|..::||
Human   131 AQYTTRISPVCLAS--SNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGS 193

  Fly   180 TTVSDQILCTRTPSGRSTCFGDAGSPLITKQDST--VVGISAFVASNGCTLGLPAGFARITSALD 242
             :::|.::|. ..:|.|:|.||:|.||:.::.:|  ::||.::...| |.:..||.:.|::....
Human   194 -SITDSMICA-GGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKN-CNVRAPAVYTRVSKFST 255

  Fly   243 WIHQRTGIAY 252
            ||:|  .|||
Human   256 WINQ--VIAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 60/229 (26%)
Tryp_SPc 29..244 CDD:214473 58/227 (26%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 61/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.